caveolin 3, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-048	50 μL

Catalog No. 89-004-048 Supplier Abnova Corporation Supplier No. H00000859A01

Description

Mouse polyclonal antibody raised against a partial recombinant CAV3.

This gene encodes a caveolin family member, which functions as a component of the caveolae plasma membranes found in most cell types. Caveolin proteins are proposed to be scaffolding proteins for organizing and concentrating certain caveolin-interacting molecules. Mutations identified in this gene lead to interference with protein oligomerization or intra-cellular routing, disrupting caveolae formation and resulting in Limb-Girdle muscular dystrophy type-1C (LGMD-1C), hyperCKemia or rippling muscle disease (RMD). Alternative splicing has been identified for this locus, with inclusion or exclusion of a differentially spliced intron. In addition, transcripts utilize multiple polyA sites and contain two potential translation initiation sites. [provided by RefSeq

Sequence: MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVP

Specifications

• Antigen: caveolin 3
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant CAV3.
• Formulation: 50% glycerol
• Gene: CAV3
• Gene Accession No.: NM_001234
• Gene Alias: LGMD1C/LQT9/MGC126100/MGC126101/MGC126129/VIP-21/VIP21
• Gene Symbols: CAV3
• Host Species: Mouse
• Immunogen: CAV3 (NP_001225, 1 a.a. ∼ 83 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 859
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum