Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
anti-CBP20, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP191755
Description
CBP20 Polyclonal specifically detects CBP20 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
CBP20 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
20 kDa nuclear cap-binding protein, Cbc2, CBP20CBC2, NCBP 20 kDa subunit, NCBP interacting protein 1, NCBP-interacting protein 1, NIP1Cell proliferation-inducing gene 55 protein, nuclear cap binding protein subunit 2, 20kD, nuclear cap binding protein subunit 2, 20kDa, nuclear cap-binding protein subunit 2 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
NCBP2 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLS | |
0.1 mL | |
Apoptosis, Core ESC Like Genes, Stem Cell Markers | |
22916 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction