CBS, Mouse, Clone: 3E1, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CBS.

Supplier:  Abnova Corporation H00000875M01

Catalog No. 89-016-466

Description

The protein encoded by this gene acts as a homotetramer to catalyze the conversion of homocysteine to cystathionine, the first step in the transsulfuration pathway. The encoded protein is allosterically activated by adenosyl-methionine and uses pyridoxal phosphate as a cofactor. Defects in this gene can cause cystathionine beta-synthase deficiency (CBSD), which can lead to homocystinuria. [provided by RefSeq

Sequence: MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFG

Specifications

• Antigen: CBS
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_000071
• Gene Symbols: CBS
• Immunogen: CBS (NP_000062, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ

• Applications: ELISA, Immunohistochemistry (PFA fixed), Immunoprecipitation, KnockDown, Western Blot
• Clone: 3E1
• Description: Mouse monoclonal antibody raised against a partial recombinant CBS.
• Gene: CBS
• Gene Alias: HIP4
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 875
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid