chromobox homolog 5 (HP1 alpha homolog, Drosophila), Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-007-278	50 μL

Catalog No. 89-007-278 Supplier Abnova Corporation Supplier No. H00023468B01

Description

Mouse polyclonal antibody raised against a full-length human CBX5 protein.

This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family. The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The encoded product is involved in the formation of functional kinetochore through interaction with essential kinetochore proteins. The gene has a pseudogene located on chromosome 3. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq

Sequence: MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS

Specifications

• Antigen: chromobox homolog 5 (HP1 alpha homolog, Drosophila)
• Applications: Immunofluorescence, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human CBX5 protein.
• Formulation: No additive
• Gene: CBX5
• Gene Accession No.: NM_012117.1
• Gene Alias: HP1/HP1A
• Gene Symbols: CBX5
• Host Species: Mouse
• Immunogen: CBX5 (NP_036249.1, 1 a.a. ∼ 191 a.a) full-length human protein.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 23468
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum