Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-CCDC90A, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP191586

Catalog No. NBP191586

Add to cart



CCDC90A Polyclonal antibody specifically detects CCDC90A in Human samples. It is validated for Western Blot.


PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
Synthetic peptide directed towards the middle region of human CCDC90A. Peptide sequence ELHQLKQQVMDEVIKVRTDTKLDFNLEKSRVKELYSLNEKKLLELRTEIV.
40 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Expected identity based on immunogen sequence: Chicken: 85%.
Western Blot
Western Blot 1:1000
C6orf79, coiled-coil domain containing 90A, coiled-coil domain-containing protein 90A, mitochondrial, FLJ20958
Immunogen affinity purified
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only