Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

cholecystokinin, Mouse, Clone: 2A5, Abnova™

Catalog No. 89018971 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-018-971 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-018-971 Supplier Abnova Corporation Supplier No. H00000885M02
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a full-length recombinant CCK.

Cholecystokinin is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages. [provided by RefSeq

Sequence: MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS

Specifications

Antigen cholecystokinin
Applications ELISA
Classification Monoclonal
Clone 2A5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full-length recombinant CCK.
Formulation PBS with no preservative; pH 7.4
Gene CCK
Gene Accession No. BC008283
Gene Alias MGC117187
Gene Symbols CCK
Host Species Mouse
Immunogen CCK (AAH08283, 1 a.a. ∼ 115 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 885
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.