chemokine (C-C motif) ligand 1, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human CCL1 protein.

Supplier:  Abnova Corporation H00006346D01P

Catalog No. 89-018-452

Description

This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine is secreted by activated T cells and displays chemotactic activity for monocytes but not for neutrophils. It binds to the chemokine receptor CCR8. [provided by RefSeq

Sequence: MQIITTALVCLLLAGMWPEDVDSKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK

Specifications

• Antigen: chemokine (C-C motif) ligand 1
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human CCL1 protein.
• Gene: CCL1
• Gene Alias: I-309/P500/SCYA1/SISe/TCA3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_002981
• Gene Symbols: CCL1
• Immunogen: CCL1 (NP_002972.1, 1 a.a. ∼ 96 a.a) full-length human protein.
• Quantity: 100 μg
• Research Discipline: Cytokines
• Gene ID (Entrez): 6346
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG