chemokine (C-C motif) ligand 14, Mouse, Clone: 3B12, Abnova™

Catalog No.	Quantity
89-000-954	100 μg

Catalog No. 89-000-954 Supplier Abnova Corporation Supplier No. H00006358M04

Description

Mouse monoclonal antibody raised against a full-length recombinant CCL14.

This gene, CCL14, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene induces changes in intracellular calcium concentration and enzyme release in monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Read-through transcripts are also expressed that include exons from the upstream cytokine gene CCL15, and are represented as GeneID: 348249. [provided by RefSeq

Sequence: TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN

Specifications

• Antigen: chemokine (C-C motif) ligand 14
• Applications: ELISA
• Classification: Monoclonal
• Clone: 3B12
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant CCL14.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CCL14
• Gene Accession No.: BC045165
• Gene Alias: CC-1/CC-3/CKb1/HCC-1/HCC-3/MCIF/NCC-2/NCC2/SCYA14/SCYL2/SY14
• Gene Symbols: CCL14
• Host Species: Mouse
• Immunogen: CCL14 (AAH45165, 20 a.a. ∼ 93 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 6358
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ