chemokine (C-C motif) ligand 15, Mouse, Clone: 4G10, Abnova™

Catalog No.	Quantity
89-000-955	100 μg

Catalog No. 89-000-955 Supplier Abnova Corporation Supplier No. H00006359M02

Description

Mouse monoclonal antibody raised against a partial recombinant CCL15.

This gene, CCL15, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene is chemotactic for T cells and monocytes and induces N-acetyl-beta-D-glucosaminidase release in monocytes. It induces changes in intracellular calcium concentration in monocytes and is thought to act through the CCR1 receptor. Read-through transcripts are expressed that include exons from the downstream cytokine gene CCL14, and are represented as GeneID: 348249. [provided by RefSeq

Sequence: NDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI

Specifications

• Antigen: chemokine (C-C motif) ligand 15
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4G10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CCL15.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CCL15
• Gene Accession No.: NM_032965
• Gene Alias: HCC-2/HMRP-2B/LKN1/Lkn-1/MIP-1d/MIP-5/NCC-3/NCC3/SCYA15/SCYL3/SY15
• Gene Symbols: CCL15
• Host Species: Mouse
• Immunogen: CCL15 (NP_116741, 25 a.a. ∼ 113 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Kinases
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 6359
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ