chemokine (C-C motif) ligand 21, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human CCL21 protein.

Supplier:  Abnova Corporation H00006366D01P

Catalog No. 89-018-256

Description

This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. Similar to other chemokines the protein encoded by this gene inhibits hemopoiesis and stimulates chemotaxis. This protein is chemotactic in vitro for thymocytes and activated T cells, but not for B cells, macrophages, or neutrophils. The cytokine encoded by this gene may also play a role in mediating homing of lymphocytes to secondary lymphoid organs. It is a high affinity functional ligand for chemokine receptor 7 (CCR7) that is expressed on T and B lymphocytes and a known receptor for another member of the cytokine family (small inducible cytokine A19). [provided by RefSeq

Sequence: MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP

Specifications

• Antigen: chemokine (C-C motif) ligand 21
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human CCL21 protein.
• Gene: CCL21
• Gene Alias: 6Ckine/CKb9/ECL/MGC34555/SCYA21/SLC/TCA4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_002989
• Gene Symbols: CCL21
• Immunogen: CCL21 (NP_002980.1, 1 a.a. ∼ 134 a.a) full-length human protein.
• Quantity: 100 μg
• Research Discipline: Cytokines
• Gene ID (Entrez): 6366
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG