chemokine (C-C motif) ligand 26, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human CCL26 protein.

Supplier:  Abnova Corporation H00010344D01P

Catalog No. 89-018-218

Description

This gene is one of two Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 7. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for normal peripheral blood eosinophils and basophils. The product of this gene is one of three related chemokines that specifically activate chemokine receptor CCR3. This chemokine may contribute to the eosinophil accumulation in atopic diseases. [provided by RefSeq

Sequence: MMGLSLASAVLLASLLSLHLGTATRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL

Specifications

• Antigen: chemokine (C-C motif) ligand 26
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human CCL26 protein.
• Gene: CCL26
• Gene Alias: IMAC/MGC126714/MIP-4a/MIP-4alpha/SCYA26/TSC-1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_006072
• Gene Symbols: CCL26
• Immunogen: CCL26 (NP_006063.1, 1 a.a. ∼ 94 a.a) full-length human protein.
• Quantity: 100 μg
• Research Discipline: Cytokines
• Gene ID (Entrez): 10344
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG