chemokine (C-C motif) ligand 27, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-018-247	100 μg

Catalog No. 89-018-247 Supplier Abnova Corporation Supplier No. H00010850D01P

Description

Rabbit polyclonal antibody raised against a full-length human CCL27 protein.

This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The protein encoded by this gene is chemotactic for skin-associated memory T lymphocytes. This cytokine may also play a role in mediating homing of lymphocytes to cutaneous sites. It specifically binds to chemokine receptor 10 (CCR10). Studies of a similar murine protein indicate that these protein-receptor interactions have a pivotal role in T cell-mediated skin inflammation. [provided by RefSeq

Sequence: MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG

Specifications

• Antigen: chemokine (C-C motif) ligand 27
• Applications: Immunofluorescence, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against a full-length human CCL27 protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CCL27
• Gene Accession No.: NM_006664
• Gene Alias: ALP/CTACK/CTAK/ESKINE/ILC/PESKY/SCYA27
• Gene Symbols: CCL27
• Host Species: Rabbit
• Immunogen: CCL27 (NP_006655.1, 1 a.a. ∼ 112 a.a) full-length human protein.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 10850
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG