cyclin D2, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-017-483	100 μg

Catalog No. 89-017-483 Supplier Abnova Corporation Supplier No. H00000894D01P

Description

Rabbit polyclonal antibody raised against a full-length human CCND2 protein.

The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. This protein has been shown to interact with and be involved in the phosphorylation of tumor suppressor protein Rb. Knockout studies of the homologous gene in mouse suggest the essential roles of this gene in ovarian granulosa and germ cell proliferation. High level expression of this gene was observed in ovarian and testicular tumors. [provided by RefSeq

Sequence: MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL

Specifications

• Antigen: cyclin D2
• Applications: Immunofluorescence, In situ PLA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against a full-length human CCND2 protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CCND2
• Gene Accession No.: NM_001759
• Gene Alias: KIAK0002/MGC102758
• Gene Symbols: CCND2
• Host Species: Rabbit
• Immunogen: CCND2 (NP_001750.1, 1 a.a. ∼ 289 a.a) full-length human protein.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Gene ID (Entrez): 894
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG