cell cycle related kinase, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human CCRK protein.

Manufacturer: Abnova Corporation H00023552D01P

Catalog No. 89-018-104

  Check Availability
Add to Cart

    Specifications

    Antigen cell cycle related kinase
    Applications Western Blotting
    Conjugate Unlabeled
    Cross Reactivity Human,Mouse
    Description cell cycle related kinase
    Format Affinity Purified
    Formulation In 1X PBS, pH 7.4
    Gene CCRK
    Gene Accession No. BC002655.2
    Gene Alias CDCH, p42
    Gene Symbols CCRK
    Host Species Rabbit
    Immunogen CCRK (AAH02655.1, 1 a.a. ∽275 a.a) full-length human protein.
    Purification Method Protein A column
    Quantity 100μg
    Regulatory Status RUO
    Research Discipline Kinases
    Species Reactivity Human, Mouse
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Polyclonal
    Gene ID (Entrez) 23552

    The protein encoded by this gene contains a kinase domain most closely related to the cyclin-dependent protein kinases. The encoded kinase activates CDK2 and is involved in cell growth. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq

    Sequence: MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMEDNQYVVQLKAVFPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHANNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGSRLYTHQVATRSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASKLPCLPIHLSCRFLSV

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit