Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CD14 molecule (B01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human CD14 protein.

Manufacturer:  Abnova Corporation H00000929B01

Catalog No. 89-005-070


Add to cart

Description

Description

CD14 is a surface protein preferentially expressed on monocytes/macrophages. It binds lipopolysaccharide binding protein and recently has been shown to bind apoptotic cells. Alternative splicing results in multiple transcript variants encoding the same isoform. [provided by RefSeq

Sequence: MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQDLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA
Specifications

Specifications

CD14
Unconjugated
No additive
BC010507
CD14
CD14 (AAH10507, 1 a.a. ~ 375 a.a) full-length human protein.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
929
Western Blot
Mouse polyclonal antibody raised against a full-length human CD14 protein.
CD14
Serum
Mouse
50 uL
Apoptosis
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit