Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89014224

CD164 molecule, sialomucin, Mouse, Clone: 4B4, Abnova™

Catalog No. 89014224 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-224 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-224 Supplier Abnova Corporation Supplier No. H00008763M10
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant CD164.

Sialomucins are a heterogeneous group of secreted or membrane-associated mucins that appear to play 2 key but opposing roles in vivo: first as cytoprotective or antiadhesive agents, and second as adhesion receptors. CD164 is a type I integral transmembrane sialomucin that functions as an adhesion receptor (Watt et al., 1998 [PubMed 9680353]; Forde et al., 2007 [PubMed 17077324]).[supplied by OMIM

Sequence: MSRLSRSLLWAATCLGVLCVLSADKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTAT

Specifications

Antigen CD164
Applications ELISA, Western Blot
Classification Monoclonal
Clone 4B4
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant CD164.
Formulation PBS with no preservative; pH 7.4
Gene CD164
Gene Accession No. BC011522
Gene Alias MGC-24/MUC-24/endolyn
Gene Symbols CD164
Host Species Mouse
Immunogen CD164 (AAH11522, 1 a.a. ∼ 115 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cell Adhesion
Primary or Secondary Primary
Gene ID (Entrez) 8763
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.