CD19 (M01A), Mouse anti-Human, Clone: 1G3, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CD19.

Supplier:  Abnova Corporation H00000930M01A

Catalog No. 89-016-488

Description

Lymphocytes proliferate and differentiate in response to various concentrations of different antigens. The ability of the B cell to respond in a specific, yet sensitive manner to the various antigens is achieved with the use of low-affinity antigen receptors. This gene encodes a cell surface molecule which assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation. [provided by RefSeq

Sequence: QPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCVPPRDSLNQSLSQD

Specifications

• Antigen: CD19
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: NM_001770
• Gene Symbols: CD19
• Immunogen: CD19 (NP_001761, 98 a.a. ∼ 187 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 930
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid

• Applications: ELISA, Western Blot
• Clone: 1G3
• Description: Mouse monoclonal antibody raised against a partial recombinant CD19.
• Gene: CD19
• Gene Alias: B4/MGC12802
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ