Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CD19, Mouse, Clone: 1G3, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CD19.

Manufacturer:  Abnova Corporation H00000930M01

Catalog No. 89-016-487


  Check Availability
Add to cart

Specifications

Description

Lymphocytes proliferate and differentiate in response to various concentrations of different antigens. The ability of the B cell to respond in a specific, yet sensitive manner to the various antigens is achieved with the use of low-affinity antigen receptors. This gene encodes a cell surface molecule which assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation. [provided by RefSeq

Sequence: QPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCVPPRDSLNQSLSQD
Description & Specifications

Specifications

CD19
1G3
CD19 molecule
CD19
Liquid
CD19
CD19 (NP_001761, 98 a.a. ∽188 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa.
100μg
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA,Western Blot
Unlabeled
In 1X PBS, pH 7.4
NM_001770
B4, MGC12802
Murine
IgG2a, κ
RUO
Primary
930
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit