Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CD19 (M01), Mouse anti-Human, Clone: 1G3, Abnova™

Catalog No. 89016487 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-016-487 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-016-487 Supplier Abnova Corporation Supplier No. H00000930M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant CD19.

Lymphocytes proliferate and differentiate in response to various concentrations of different antigens. The ability of the B cell to respond in a specific, yet sensitive manner to the various antigens is achieved with the use of low-affinity antigen receptors. This gene encodes a cell surface molecule which assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation. [provided by RefSeq

Sequence: QPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCVPPRDSLNQSLSQD

Specifications

Antigen CD19
Applications ELISA, Immunoprecipitation, Western Blot
Classification Monoclonal
Clone 1G3
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant CD19.
Formulation PBS with no preservative; pH 7.4
Gene CD19
Gene Accession No. NM_001770
Gene Alias B4/MGC12802
Gene Symbols CD19
Host Species Mouse
Immunogen CD19 (NP_001761, 98 a.a. ∼ 187 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 930
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.