CD19, Mouse, Clone: 1G3, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CD19.

Manufacturer: Abnova Corporation H00000930M01

Catalog No. 89-016-487

  Check Availability
Add to Cart

    Specifications

    Antigen CD19
    Applications Enzyme Linked Immunosorbent Assay,Western Blotting
    Clone 1G3
    Conjugate Unlabeled
    Cross Reactivity Human
    Description CD19 molecule
    Format Liquid
    Formulation In 1X PBS, pH 7.4
    Gene CD19
    Gene Accession No. NM_001770
    Gene Alias B4, MGC12802
    Gene Symbols CD19
    Host Species Mouse
    Immunogen CD19 (NP_001761, 98 a.a. ∽188 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa.
    Isotype IgG2a, κ
    Quantity 100μg
    Regulatory Status RUO
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Monoclonal
    Gene ID (Entrez) 930

    Lymphocytes proliferate and differentiate in response to various concentrations of different antigens. The ability of the B cell to respond in a specific, yet sensitive manner to the various antigens is achieved with the use of low-affinity antigen receptors. This gene encodes a cell surface molecule which assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation. [provided by RefSeq

    Sequence: QPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCVPPRDSLNQSLSQD

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit