CD1C, Mouse, Clone: 4B11, Abnova™

Catalog No.	Quantity
89-016-477	100 μg

Catalog No. 89-016-477 Supplier Abnova Corporation Supplier No. H00000911M02

Description

Mouse monoclonal antibody raised against a partial recombinant CD1C.

This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene is broadly distributed throughout the endocytic system via a tyrosine-based motif in the cytoplasmic tail. Alternatively spliced transcript variants of this gene have been observed, but their full-length nature is not known. [provided by RefSeq

Sequence: SNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNLIRSTC

Specifications

• Antigen: CD1c
• Applications: ELISA
• Classification: Monoclonal
• Clone: 4B11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CD1C.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CD1C
• Gene Accession No.: NM_001765
• Gene Alias: BDCA1/CD1/CD1A/R7
• Gene Symbols: CD1C
• Host Species: Mouse
• Immunogen: CD1C (NP_001756, 77 a.a. ∼ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 911
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ