CD247 molecule, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-017-485	100 μg

Catalog No. 89-017-485 Supplier Abnova Corporation Supplier No. H00000919D01P

Description

Rabbit polyclonal antibody raised against a full-length human CD247 protein.

The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq

Sequence: MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR

Specifications

• Antigen: CD247 molecule
• Applications: In situ PLA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against a full-length human CD247 protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CD247
• Gene Accession No.: NM_198053
• Gene Alias: CD3-ZETA/CD3H/CD3Q/CD3Z/T3Z/TCRZ
• Gene Symbols: CD247
• Host Species: Rabbit
• Immunogen: CD247 (NP_932170.1, 1 a.a. ∼ 164 a.a) full-length human protein.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Membrane Receptors
• Primary or Secondary: Primary
• Gene ID (Entrez): 919
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG