CD3d molecule, delta (CD3-TCR complex), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human CD3D protein.

Supplier:  Abnova Corporation H00000915B01

Catalog No. 89-005-065

Description

The protein encoded by this gene is part of the T-cell receptor/CD3 complex (TCR/CD3 complex) and is involved in T-cell development and signal transduction. The encoded membrane protein represents the delta subunit of the CD3 complex, and along with four other CD3 subunits, binds either TCR alpha/beta or TCR gamma/delta to form the TCR/CD3 complex on the surface of T-cells. Defects in this gene are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (SCIDBNK). Two transcript variants encoding different isoforms have been found for this gene. Other variants may also exist, but the full-length natures of their transcripts has yet to be defined. [provided by RefSeq

Sequence: MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK

Specifications

• Antigen: CD3d
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human CD3D protein.
• Gene: CD3D
• Gene Alias: CD3-DELTA/T3D
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Membrane Receptors
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: NM_000732
• Gene Symbols: CD3D
• Immunogen: CD3D (NP_000723, 1 a.a. ∼ 171 a.a) full-length human protein.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 915
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.