CD3Z, Mouse, Clone: 4A12-F6, Abnova™

Catalog No.	Quantity
89-016-481	100 μg

Catalog No. 89-016-481 Supplier Abnova Corporation Supplier No. H00000919M01

Description

Mouse monoclonal antibody raised against a full-length recombinant CD3Z.

The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq

Sequence: MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR

Specifications

• Antigen: CD3Z
• Applications: ELISA, Immunohistochemistry (PFA fixed), Immunoprecipitation, Western Blot
• Classification: Monoclonal
• Clone: 4A12-F6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant CD3Z.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CD247
• Gene Accession No.: BC025703
• Gene Alias: CD3-ZETA/CD3H/CD3Q/CD3Z/T3Z/TCRZ
• Gene Symbols: CD247
• Host Species: Mouse
• Immunogen: CD3Z (AAH25703, 1 a.a. ∼ 164 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 919
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ