CD53 molecule, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human CD53 protein.

Manufacturer:  Abnova Corporation H00000963B01

Catalog No. 89-005-086

Description

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. It contributes to the transduction of CD2-generated signals in T cells and natural killer cells and has been suggested to play a role in growth regulation. Familial deficiency of this gene has been linked to an immunodeficiency associated with recurrent infectious diseases caused by bacteria, fungi and viruses. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq

Sequence: MGMSSLKLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNFGVLFHNLPSLTLGNVFVIVGSIIMVVAFLGCMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHSNFLYIGIITICVCVIEVLGMSFALTLNCQIDKTSQTIGL

Specifications

• Antigen: CD53
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: NM_000560.3
• Gene Alias: MOX44|TSPAN25
• Host Species: Mouse
• Quantity: 50 uL
• Storage Requirements: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Primary or Secondary: Primary
• Gene ID (Entrez): 963

• Applications: Western Blot
• Description: Mouse polyclonal antibody raised against a full-length human CD53 protein.
• Gene: CD53
• Format: Serum
• Gene Symbols: CD53
• Immunogen: CD53 (NP_000551.1, 1 a.a. ~ 219 a.a) full-length human protein.
• Regulatory Status: RUO
• Whole Molecule: Y
• Monoclonal or Polyclonal: Polyclonal
• Target Species: Human