CD58 molecule, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human CD58 protein.

Supplier:  Abnova Corporation H00000965D01P

Catalog No. 89-017-496

Description

This gene encodes a member of the immunoglobulin superfamily. The encoded protein is a ligand of the T lymphocyte CD2 protein, and functions in adhesion and activation of T lymphocytes. The protein is localized to the plasma membrane. Alternatively spliced transcript variants have been described. [provided by RefSeq

Sequence: MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKCDRKPDRTNSN

Specifications

• Antigen: CD58
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human CD58 protein.
• Gene: CD58
• Gene Alias: LFA-3/LFA3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 965
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_001779.1
• Gene Symbols: CD58
• Immunogen: CD58 (NP_001770.1, 1 a.a. ∼ 250 a.a) full-length human protein.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody