Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CD7, Mouse, Clone: 1B8, Abnova™

Catalog No. 89016483 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-016-483 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-016-483 Supplier Abnova Corporation Supplier No. H00000924M04
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a full-length recombinant CD7.

This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development. [provided by RefSeq

Sequence: PGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ

Specifications

Antigen CD7
Applications ELISA, Immunoprecipitation, Western Blot
Classification Monoclonal
Clone 1B8
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant CD7.
Formulation PBS with no preservative; pH 7.4
Gene CD7
Gene Accession No. BC009293
Gene Alias GP40/LEU-9/TP41/Tp40
Gene Symbols CD7
Host Species Mouse
Immunogen CD7 (AAH09293, 21 a.a. ∼ 240 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 924
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.