CD79b molecule, immunoglobulin-associated beta, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human CD79B protein.

Supplier:  Abnova Corporation H00000974D01P

Catalog No. 89-017-498

Description

The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig noncovalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq

Sequence: MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE

Specifications

• Antigen: CD79b molecule, immunoglobulin-associated beta
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human CD79B protein.
• Gene: CD79B
• Gene Alias: B29/IGB
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_000626
• Gene Symbols: CD79B
• Immunogen: CD79B (NP_000617.1, 1 a.a. ∼ 229 a.a) full-length human protein.
• Quantity: 100 μg
• Research Discipline: Membrane Receptors
• Gene ID (Entrez): 974
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG