CD8B1, Mouse, Clone: 4C8, Abnova™

Catalog No.	Quantity
89-016-485	100 μg

Catalog No. 89-016-485 Supplier Abnova Corporation Supplier No. H00000926M07

Description

Mouse monoclonal antibody raised against a partial recombinant CD8B1.

The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognize antigen displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The functional coreceptor is either a homodimer composed of two alpha chains, or a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 beta chain isoforms. Multiple alternatively spliced transcript variants encoding distinct membrane associated or secreted isoforms have been described. A pseudogene, also located on chromosome 2, has been identified. [provided by RefSeq

Sequence: QQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQ

Specifications

• Antigen: Cd8b1
• Applications: ELISA
• Classification: Monoclonal
• Clone: 4C8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CD8B1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CD8B
• Gene Accession No.: NM_004931
• Gene Alias: CD8B1/LYT3/Leu2/Ly3/MGC119115
• Gene Symbols: CD8B
• Host Species: Mouse
• Immunogen: CD8B1 (NP_004922, 23 a.a. ∼ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 926
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ