Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CD9, Mouse, Clone: 4A2, Abnova™

Catalog No. 89016486 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-016-486 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-016-486 Supplier Abnova Corporation Supplier No. H00000928M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant CD9.

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It can modulate cell adhesion and migration and also trigger platelet activation and aggregation. In addition, the protein appears to promote muscle cell fusion and support myotube maintenance. [provided by RefSeq

Sequence: SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI

Specifications

Antigen CD9
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 4A2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant CD9.
Formulation PBS with no preservative; pH 7.4
Gene CD9
Gene Accession No. BC011988
Gene Alias 5H9/BA2/BTCC-1/DRAP-27/GIG2/MIC3/MRP-1/P24/TSPAN29
Gene Symbols CD9
Host Species Mouse
Immunogen CD9 (AAH11988, 112 a.a. ∼ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 928
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.