Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CDC14 cell division cycle 14 homolog B (S. cerevisiae), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant CDC14B.

Manufacturer:  Abnova Corporation H00008555A01

Catalog No. 89-004-396


Add to cart

Description

Description

The protein encoded by this gene is a member of the dual specificity protein tyrosine phosphatase family. This protein is highly similar to Saccharomyces cerevisiae Cdc14, a protein tyrosine phosphatase involved in the exit of cell mitosis and initiation of DNA replication, which suggests the role in cell cycle control. This protein has been shown to interact with and dephosphorylates tumor suppressor protein p53, and is thought to regulate the function of p53. Alternative splice of this gene results in 3 transcript variants encoding distinct isoforms. [provided by RefSeq

Sequence: LVMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEPEPYSDDDEINGVTQGDRLRALKSRRQSKTNAIPLTLSISRTKTVLR
Specifications

Specifications

CDC14 cell division cycle 14 homolog B (S. cerevisiae)
Unconjugated
50% glycerol
NM_003671
CDC14B3|Cdc14B1|Cdc14B2|hCDC14B
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
8555
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant CDC14B.
CDC14B
Serum
CDC14B
CDC14B (NP_003662, 360 a.a. ~ 459 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human, Murine
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit