CDC14 cell division cycle 14 homolog B (S. cerevisiae), Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-396	50 μL

Catalog No. 89-004-396 Supplier Abnova Corporation Supplier No. H00008555A01

Description

Mouse polyclonal antibody raised against a partial recombinant CDC14B.

The protein encoded by this gene is a member of the dual specificity protein tyrosine phosphatase family. This protein is highly similar to Saccharomyces cerevisiae Cdc14, a protein tyrosine phosphatase involved in the exit of cell mitosis and initiation of DNA replication, which suggests the role in cell cycle control. This protein has been shown to interact with and dephosphorylates tumor suppressor protein p53, and is thought to regulate the function of p53. Alternative splice of this gene results in 3 transcript variants encoding distinct isoforms. [provided by RefSeq

Sequence: LVMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEPEPYSDDDEINGVTQGDRLRALKSRRQSKTNAIPLTLSISRTKTVLR

Specifications

• Antigen: CDC14 cell division cycle 14 homolog B (S. cerevisiae)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant CDC14B.
• Formulation: 50% glycerol
• Gene: CDC14B
• Gene Accession No.: NM_003671
• Gene Alias: CDC14B3/Cdc14B1/Cdc14B2/hCDC14B
• Gene Symbols: CDC14B
• Host Species: Mouse
• Immunogen: CDC14B (NP_003662, 360 a.a. ∼ 459 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 8555
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum