CDC2, Mouse, Clone: 1G10, Abnova™

Catalog No.	Quantity
89-123-144	100 μg

Catalog No. 89-123-144 Supplier Abnova Corporation Supplier No. H00000983M03

Description

Mouse monoclonal antibody raised against a partial recombinant CDC2.

The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase transitions of eukaryotic cell cycle. Mitotic cyclins stably associate with this protein and function as regulatory subunits. The kinase activity of this protein is controlled by cyclin accumulation and destruction through the cell cycle. The phosphorylation and dephosphorylation of this protein also play important regulatory roles in cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: DQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM

Specifications

• Antigen: CDC2
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 1G10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CDC2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CDC2
• Gene Accession No.: BC014563
• Gene Alias: CDC28A/CDK1/DKFZp686L20222/MGC111195
• Gene Symbols: CDC2
• Host Species: Mouse
• Immunogen: CDC2 (AAH14563, 211 a.a. ∼ 297 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 983
• Target Species: Human, Mouse, Rat
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1