CDC5L, Mouse, Clone: 3C12, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CDC5L.

Supplier:  Abnova Corporation H00000988M08

Catalog No. 89-021-015

Description

The protein encoded by this gene shares a significant similarity with Schizosaccharomyces pombe cdc5 gene product, which is a cell cycle regulator important for G2/M transition. This protein has been demonstrated to act as a positive regulator of cell cycle G2/M progression. It was also found to be an essential component of a non-snRNA spliceosome, which contains at least five additional protein factors and is required for the second catalytic step of pre-mRNA splicing. [provided by RefSeq

Sequence: ILLGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKSKF

Specifications

• Antigen: CDC5L
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_001253
• Gene Symbols: CDC5L
• Immunogen: CDC5L (NP_001244, 719 a.a. ∼ 802 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ

• Applications: ELISA, Western Blot
• Clone: 3C12
• Description: Mouse monoclonal antibody raised against a partial recombinant CDC5L.
• Gene: CDC5L
• Gene Alias: CEF1/KIAA0432/PCDC5RP/dJ319D22.1/hCDC5
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 988
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid