cadherin 17, LI cadherin (liver-intestine), Mouse, Clone: 1H3, Abnova™

Catalog No.	Quantity
89-014-073	100 μg

Catalog No. 89-014-073 Supplier Abnova Corporation Supplier No. H00001015M01

Description

Mouse monoclonal antibody raised against a partial recombinant CDH17.

This gene is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. The encoded protein is cadherin-like, consisting of an extracellular region, containing 7 cadherin domains, and a transmembrane region but lacking the conserved cytoplasmic domain. The protein is a component of the gastrointestinal tract and pancreatic ducts, acting as an intestinal proton-dependent peptide transporter in the first step in oral absorption of many medically important peptide-based drugs. The protein may also play a role in the morphological organization of liver and intestine. Alternative splicing results in multiple transcript variants. [provided by RefSeq

Sequence: EGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIEVKDINDNRPTFLQSKY

Specifications

• Antigen: cadherin 17, LI cadherin (liver-intestine)
• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 1H3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CDH17.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CDH17
• Gene Accession No.: NM_004063
• Gene Alias: CDH16/FLJ26931/HPT-1/HPT1/MGC138218/MGC142024
• Gene Symbols: CDH17
• Host Species: Mouse
• Immunogen: CDH17 (NP_004054, 24 a.a. ∼ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1015
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ