CDH18, Mouse, Clone: 6F7, Abnova™

Catalog No.	Quantity
89-021-020	100 μg

Catalog No. 89-021-020 Supplier Abnova Corporation Supplier No. H00001016M01

Description

Mouse monoclonal antibody raised against a partial recombinant CDH18.

This gene encodes a type II classical cadherin from the cadherin superfamily of integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. This particular cadherin is expressed specifically in the central nervous system and is putatively involved in synaptic adhesion, axon outgrowth and guidance. [provided by RefSeq

Sequence: DLLSHVTVGIRVLDVNDNPPELAREYDIIVCENSKPGQVIHTISATDKDDFANGPRFNFFLDERLPVNPNFTLKDNEDNTASILTRRRRFSRTVQDVYYLPIMISDGGIP

Specifications

• Antigen: CDH18
• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 6F7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CDH18.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CDH18
• Gene Accession No.: NM_004934
• Gene Alias: CDH14/CDH14L/CDH24/EY-CADHERIN
• Gene Symbols: CDH18
• Host Species: Mouse
• Immunogen: CDH18 (NP_004925, 467 a.a. ∼ 576 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1016
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ