CDH4, Mouse, Clone: 2E2, Abnova™

Catalog No.	Quantity
89-021-017	100 μg

Catalog No. 89-021-017 Supplier Abnova Corporation Supplier No. H00001002M01

Description

Mouse monoclonal antibody raised against a partial recombinant CDH4.

This gene is a classical cadherin from the cadherin superfamily. The encoded protein is a calcium-dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Based on studies in chicken and mouse, this cadherin is thought to play an important role during brain segmentation and neuronal outgrowth. In addition, a role in kidney and muscle development is indicated. Of particular interest are studies showing stable cis-heterodimers of cadherins 2 and 4 in cotransfected cell lines. Previously thought to interact in an exclusively homophilic manner, this is the first evidence of cadherin heterodimerization. [provided by RefSeq

Sequence: AADADVDPNIGPYVFELPFVPAAVRKNWTITRLNGDYAQLSLRILYLEAGMYDVPIIVTDSGNPPLSNTSIIKVKVCPCDDNGDCTTIGAVAAAGLGTGA

Specifications

• Antigen: CDH4
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2E2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CDH4.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CDH4
• Gene Accession No.: NM_001794
• Gene Alias: CAD4/FLJ22202/FLJ40547/MGC126700/MGC138355/RCAD
• Gene Symbols: CDH4
• Host Species: Mouse
• Immunogen: CDH4 (NP_001785, 635 a.a. ∼ 734 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1002
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ