CDH6, Mouse, Clone: 2F2, Abnova™

Catalog No.	Quantity
89-021-018	100 μg

Catalog No. 89-021-018 Supplier Abnova Corporation Supplier No. H00001004M05

Description

Mouse monoclonal antibody raised against a partial recombinant CDH6.

This gene encodes a type II classical cadherin from the cadherin superfamily. The encoded membrane protein is a calcium dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Cadherins mediate cell-cell binding in a homophilic manner, contributing to the sorting of heterogeneous cell types and the maintenance of orderly structures such as epithelium. Strong transcriptional expression of this gene has been observed in hepatocellular and renal carcinoma cell lines, suggesting a possible role in metastasis and invasion. [provided by RefSeq

Sequence: DKDDPYSGHQFSFSLAPEAASGSNFTIQDNKDNTAGILTRKNGYNRHEMSTYLLPVVISDNDYPVQSSTGTVTVRVCACDHHGNMQSCHAEALIHPTGLS

Specifications

• Antigen: CDH6
• Applications: ELISA, KnockDown, Western Blot
• Classification: Monoclonal
• Clone: 2F2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CDH6.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CDH6
• Gene Accession No.: NM_004932
• Gene Alias: KCAD
• Gene Symbols: CDH6
• Host Species: Mouse
• Immunogen: CDH6 (NP_004923, 513 a.a. ∼ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1004
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ