cyclin-dependent kinase 7, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-059	50 μL

Catalog No. 89-004-059 Supplier Abnova Corporation Supplier No. H00001022A01

Description

Mouse polyclonal antibody raised against a partial recombinant CDK7.

The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle. [provided by RefSeq

Sequence: MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQ

Specifications

• Antigen: cyclin-dependent kinase 7
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant CDK7.
• Formulation: 50% glycerol
• Gene: CDK7
• Gene Accession No.: BC000834
• Gene Alias: CAK1/CDKN7/MO15/STK1/p39MO15
• Gene Symbols: CDK7
• Host Species: Mouse
• Immunogen: CDK7 (AAH00834, 1 a.a. ∼ 130 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 1022
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum