CDK8, Mouse, Clone: 2E6, Abnova™

Catalog No.	Quantity
89-021-031	100 μg

Catalog No. 89-021-031 Supplier Abnova Corporation Supplier No. H00001024M04

Description

Mouse monoclonal antibody raised against a partial recombinant CDK8.

The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This kinase and its regulatory subunit cyclin C are components of the RNA polymerase II holoenzyme complex, which phosphorylates the carboxy-terminal domain (CTD) of the largest subunit of RNA polymerase II. This kinase has also been shown to regulate transcription by targeting the CDK7/cyclin H subunits of the general transcription initiation factor IIH (TFIIH), thus providing a link between the 'Mediator-like' protein complexes and the basal transcription machinery. [provided by RefSeq]

Sequence: QQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY

Specifications

• Antigen: CDK8
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2E6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CDK8.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CDK8
• Gene Accession No.: NM_001260
• Gene Alias: K35/MGC126074/MGC126075
• Gene Symbols: CDK8
• Host Species: Mouse
• Immunogen: CDK8 (NP_001251, 375 a.a. ∼ 464 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1024
• Target Species: Human, Mouse, Rat
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ