cyclin-dependent kinase-like 1 (CDC2-related kinase), Mouse, Clone: 1F12, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CDKL1.

Supplier:  Abnova Corporation H00008814M03

Catalog No. 89-001-101

Description

This gene product is a member of a large family of CDC2-related serine/threonine protein kinases. It accumulates primarily in the nucleus. Alternative splice variants encoding different protein isoforms have been described, but their full-length nature has not been determined. [provided by RefSeq

Sequence: YPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKEHNKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNYRFPNI

Specifications

• Antigen: cyclin-dependent kinase-like 1 (CDC2-related kinase)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_004196
• Gene Symbols: CDKL1
• Immunogen: CDKL1 (NP_004187, 259 a.a. ∼ 358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 1F12
• Description: Mouse monoclonal antibody raised against a partial recombinant CDKL1.
• Gene: CDKL1
• Gene Alias: KKIALRE/p42
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 8814
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ