cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4), Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-017-509	100 μg

Catalog No. 89-017-509 Supplier Abnova Corporation Supplier No. H00001032D01P

Description

Rabbit polyclonal antibody raised against a full-length human CDKN2D protein.

The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to form a stable complex with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. The abundance of the transcript of this gene was found to oscillate in a cell-cycle dependent manner with the lowest expression at mid G1 and a maximal expression during S phase. The negative regulation of the cell cycle involved in this protein was shown to participate in repressing neuronal proliferation, as well as spermatogenesis. Two alternatively spliced variants of this gene, which encode an identical protein, have been reported. [provided by RefSeq

Sequence: MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL

Specifications

• Antigen: cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
• Applications: Immunofluorescence, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against a full-length human CDKN2D protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CDKN2D
• Gene Accession No.: NM_001800
• Gene Alias: INK4D/p19/p19-INK4D
• Gene Symbols: CDKN2D
• Host Species: Rabbit
• Immunogen: CDKN2D (NP_001791.1, 1 a.a. ∼ 166 a.a) full-length human protein.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Gene ID (Entrez): 1032
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG