Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89021039

CDSN, Mouse, Clone: 6F11, Abnova™

Catalog No. 89021039 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-021-039 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-021-039 Supplier Abnova Corporation Supplier No. H00001041M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant CDSN.

This gene encodes a protein found in corneodesmosomes, which localize to human epidermis and other cornified squamous epithelia. During maturation of the cornified layers, the protein undergoes a series of cleavages, which are thought to be required for desquamation. The gene is located in the major histocompatibility complex (MHC) class I region on chromosome 6. [provided by RefSeq

Sequence: YLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPPISEGKYFSSNP

Specifications

Antigen CDSN
Applications ELISA, Western Blot
Classification Monoclonal
Clone 6F11
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant CDSN.
Formulation PBS with no preservative; pH 7.4
Gene CDSN
Gene Accession No. NM_001264
Gene Alias D6S586E/HTSS/S
Gene Symbols CDSN
Host Species Mouse
Immunogen CDSN (NP_001255, 306 a.a. ∼ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1041
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.