Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89021045

CDX1, Mouse, Clone: 1E9, Abnova™

Catalog No. 89021045 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-021-045 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-021-045 Supplier Abnova Corporation Supplier No. H00001044M18
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant CDX1.

This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded DNA-binding protein regulates intestine-specific gene expression and enterocyte differentiation. It has been shown to induce expression of the intestinal alkaline phosphatase gene, and inhibit beta-catenin/T-cell factor transcriptional activity. [provided by RefSeq

Sequence: MYVGYVLDKDSPVYPGPARPASLGLGPANYGPPAPPPAPPQYPDFSSYSHVEPAPAPPTAWGAPFPAPKDDWAAAYGPGPAAPAASPASLAFGPPPDFSPVPAPPGPGPGLLAQPLGGPGTPSSPGAQRPTPYEWMRRS*

Specifications

Antigen CDX1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1E9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant CDX1.
Formulation PBS with no preservative; pH 7.4
Gene CDX1
Gene Accession No. NM_001804
Gene Alias MGC116915
Gene Symbols CDX1
Host Species Mouse
Immunogen CDX1 (NP_001795, 1 a.a. ∼ 139 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1044
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.