CDX1, Mouse, Clone: 3C5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CDX1.

Supplier:  Abnova Corporation H00001044M04

Catalog No. 89-021-042

Description

This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded DNA-binding protein regulates intestine-specific gene expression and enterocyte differentiation. It has been shown to induce expression of the intestinal alkaline phosphatase gene, and inhibit beta-catenin/T-cell factor transcriptional activity. [provided by RefSeq

Sequence: GAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKK

Specifications

• Antigen: CDX1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_001804
• Gene Symbols: CDX1
• Immunogen: CDX1 (NP_001795, 126 a.a. ∼ 215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ

• Applications: ELISA, Immunofluorescence
• Clone: 3C5
• Description: Mouse monoclonal antibody raised against a partial recombinant CDX1.
• Gene: CDX1
• Gene Alias: MGC116915
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 1044
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid