CEACAM1, Mouse, Clone: 2F10, Abnova™

Catalog No.	Quantity
89-016-306	100 μg

Catalog No. 89-016-306 Supplier Abnova Corporation Supplier No. H00000634M01

Description

Mouse monoclonal antibody raised against a partial recombinant CEACAM1.

This gene encodes a member of the carcinoembryonic antigen (CEA) gene family, which belongs to the immunoglobulin superfamily. Two subgroups of the CEA family, the CEA cell adhesion molecules and the pregnancy-specific glycoproteins, are located within a 1.2Mb cluster on the long arm of chromosome 19. Eleven pseudogenes of the CEA cell adhesion molecule subgroup are also found in the cluster. The encoded protein was originally described in bile ducts of liver as biliary glycoprotein. Subsequently, it was found to be a cell-cell adhesion molecule detected on leukocytes, epithelia, and endothelia. The encoded protein mediates cell adhesion via homophilic as well as heterophilic binding to other proteins of the subgroup. Multiple cellular activities have been attributed to the encoded protein, including roles in the differentiation and arrangement of tissue three-dimensional structure, angiogenesis, apoptosis, tumor suppression, metastasis, and the modulation of innate and adaptive immune responses. Multiple transcript variants encoding different isoforms have been reported, but the full-length nature of only two has been determined. [provided by RefSeq

Sequence: VTGCNRTTVKTIIVTELSPVVAKPQIKASKTTVTGDKDSVNLTCSTNDTGISIRWFFKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNV

Specifications

• Antigen: CEACAM1
• Applications: ELISA
• Classification: Monoclonal
• Clone: 2F10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CEACAM1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CEACAM1
• Gene Accession No.: BC014473
• Gene Alias: BGP/BGP1/BGPI
• Gene Symbols: CEACAM1
• Host Species: Mouse
• Immunogen: CEACAM1 (AAH14473, 305 a.a. ∼ 414 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 634
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ