CCAAT/enhancer binding protein (C/EBP), gamma, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-061	50 μL

Catalog No. 89-004-061 Supplier Abnova Corporation Supplier No. H00001054A01

Description

Mouse polyclonal antibody raised against a full-length recombinant CEBPG.

The C/EBP family of transcription factors regulates viral and cellular CCAAT/enhancer element-mediated transcription. C/EBP proteins contain the bZIP region, which is characterized by two motifs in the C-terminal half of the protein: a basic region involved in DNA binding and a leucine zipper motif involved in dimerization. The C/EBP family consist of several related proteins, C/EBP alpha, C/EBP beta, C/EBP gamma, and C/EBP delta, that form homodimers and that form heterodimers with each other. CCAAT/enhancer binding protein gamma may cooperate with Fos to bind PRE-I enhancer elements. [provided by RefSeq

Sequence: MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ

Specifications

• Antigen: CCAAT/enhancer binding protein (C/EBP), gamma
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length recombinant CEBPG.
• Formulation: 50% glycerol
• Gene: CEBPG
• Gene Accession No.: BC013128
• Gene Alias: GPE1BP/IG/EBP-1
• Gene Symbols: CEBPG
• Host Species: Mouse
• Immunogen: CEBPG (AAH13128, 1 a.a. ∼ 150 a.a) full-length recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 1054
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum