CCAAT/enhancer binding protein (C/EBP), gamma, Mouse, Clone: 3A3-1A6, Abnova™

Catalog No.	Quantity
89-014-074	100 μg

Catalog No. 89-014-074 Supplier Abnova Corporation Supplier No. H00001054M01

Description

Mouse monoclonal antibody raised against a full-length recombinant CEBPG.

The C/EBP family of transcription factors regulates viral and cellular CCAAT/enhancer element-mediated transcription. C/EBP proteins contain the bZIP region, which is characterized by two motifs in the C-terminal half of the protein: a basic region involved in DNA binding and a leucine zipper motif involved in dimerization. The C/EBP family consist of several related proteins, C/EBP alpha, C/EBP beta, C/EBP gamma, and C/EBP delta, that form homodimers and that form heterodimers with each other. CCAAT/enhancer binding protein gamma may cooperate with Fos to bind PRE-I enhancer elements. [provided by RefSeq

Sequence: MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ

Specifications

• Antigen: CCAAT/enhancer binding protein (C/EBP), gamma
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3A3-1A6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant CEBPG.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CEBPG
• Gene Accession No.: BC013128
• Gene Alias: GPE1BP/IG/EBP-1
• Gene Symbols: CEBPG
• Host Species: Mouse
• Immunogen: CEBPG (AAH13128, 1 a.a. ∼ 150 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1054
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ