centrin, EF-hand protein, 1, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human CETN1 protein.

Supplier:  Abnova Corporation H00001068D01P

Catalog No. 89-017-513

Description

The protein encoded by this gene plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. This encoded protein is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle. [provided by RefSeq

Sequence: MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY

Specifications

• Antigen: centrin, EF-hand protein, 1
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human CETN1 protein.
• Gene: CETN1
• Gene Alias: CEN1/CETN
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Product Type: Antibody

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_004066
• Gene Symbols: CETN1
• Immunogen: CETN1 (NP_004057.1, 1 a.a. ∼ 172 a.a) full-length human protein.
• Quantity: 100 μg
• Research Discipline: Cell Cycle
• Gene ID (Entrez): 1068
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG