CETN3, Mouse, Clone: 3E6, Abnova™

Catalog No.	Quantity
89-021-063	50 μg

Catalog No. 89-021-063 Supplier Abnova Corporation Supplier No. H00001070M01

Description

Mouse monoclonal antibody raised against a partial recombinant CETN3.

The protein encoded by this gene contains four EF-hand calcium binding domains, and is a member of the centrin protein family. Centrins are evolutionarily conserved proteins similar to the CDC31 protein of S. cerevisiae. Yeast CDC31 is located at the centrosome of interphase and mitotic cells, where it plays a fundamental role in centrosome duplication and separation. Multiple forms of the proteins similar to the yeast centrin have been identified in human and other mammalian cells, some of which have been shown to be associated with centrosome fractions. This protein appears to be one of the most abundant centrins associated with centrosome, which suggests a similar function to its yeast counterpart. [provided by RefSeq

Sequence: MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPH

Specifications

• Antigen: CETN3
• Applications: ELISA, KnockDown, Western Blot
• Classification: Monoclonal
• Clone: 3E6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CETN3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CETN3
• Gene Accession No.: BC005383
• Gene Alias: CEN3/MGC12502/MGC138245
• Gene Symbols: CETN3
• Host Species: Mouse
• Immunogen: CETN3 (AAH05383, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 50 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1070
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ