cofilin 1 (nonmuscle), Mouse, Clone: 1A1, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant CFL1.

Supplier:  Abnova Corporation H00001072M04

Catalog No. 89-014-075

Description

Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus.[supplied by OMIM

Sequence: MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFAKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEGVKDRCTLAEKLGGSAVISLEGKPL

Specifications

• Antigen: cofilin 1 (non-muscle)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC011005
• Gene Symbols: CFL1
• Immunogen: CFL1 (AAH11005, 1 a.a. ∼ 166 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 1A1
• Description: Mouse monoclonal antibody raised against a full length recombinant CFL1.
• Gene: CFL1
• Gene Alias: CFL
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1072
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ