chromatin assembly factor 1, subunit B (p60), Mouse, Clone: 2G7, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CHAF1B.

Supplier:  Abnova Corporation H00008208M01

Catalog No. 89-001-076

Description

Chromatin assembly factor I (CAF-I) is required for the assembly of histone octamers onto newly-replicated DNA. CAF-I is composed of three protein subunits, p50, p60, and p150. The protein encoded by this gene corresponds to the p60 subunit and is required for chromatin assembly after replication. The encoded protein is differentially phosphorylated in a cell cycle-dependent manner. In addition, it is normally found in the nucleus except during mitosis, when it is released into the cytoplasm. This protein is a member of the WD-repeat HIR1 family and may also be involved in DNA repair. [provided by RefSeq

Sequence: QKKRVAFNVSKMLSGIGAEGEARSYRMFHDDSMKSFFRRLSFTPDGSLLLTPAGCVESGENVMNTTYVFSRKNLKRPIAHLPCPGKATLAVRCCPVYFEL

Specifications

• Antigen: chromatin assembly factor 1, subunit B (p60)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC021218
• Gene Symbols: CHAF1B
• Immunogen: CHAF1B (AAH21218, 201 a.a. ∼ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 2G7
• Description: Mouse monoclonal antibody raised against a partial recombinant CHAF1B.
• Gene: CHAF1B
• Gene Alias: CAF-1/CAF-IP60/CAF1/CAF1A/CAF1P60/MPHOSPH7/MPP7
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 8208
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2b κ