chromatin assembly factor 1, subunit B (p60), Mouse, Clone: 2G7, Abnova™

Catalog No.	Quantity
89-001-076	100 μg

Catalog No. 89-001-076 Supplier Abnova Corporation Supplier No. H00008208M01

Description

Mouse monoclonal antibody raised against a partial recombinant CHAF1B.

Chromatin assembly factor I (CAF-I) is required for the assembly of histone octamers onto newly-replicated DNA. CAF-I is composed of three protein subunits, p50, p60, and p150. The protein encoded by this gene corresponds to the p60 subunit and is required for chromatin assembly after replication. The encoded protein is differentially phosphorylated in a cell cycle-dependent manner. In addition, it is normally found in the nucleus except during mitosis, when it is released into the cytoplasm. This protein is a member of the WD-repeat HIR1 family and may also be involved in DNA repair. [provided by RefSeq

Sequence: QKKRVAFNVSKMLSGIGAEGEARSYRMFHDDSMKSFFRRLSFTPDGSLLLTPAGCVESGENVMNTTYVFSRKNLKRPIAHLPCPGKATLAVRCCPVYFEL

Specifications

• Antigen: chromatin assembly factor 1, subunit B (p60)
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2G7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CHAF1B.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CHAF1B
• Gene Accession No.: BC021218
• Gene Alias: CAF-1/CAF-IP60/CAF1/CAF1A/CAF1P60/MPHOSPH7/MPP7
• Gene Symbols: CHAF1B
• Host Species: Mouse
• Immunogen: CHAF1B (AAH21218, 201 a.a. ∼ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 8208
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ