CHD1 (M04), Mouse anti-Human, Clone: 1G2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CHD1.

Supplier:  Abnova Corporation H00001105M04

Catalog No. 89-021-071

Description

The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template. [provided by RefSeq

Sequence: IKALKDSSSGTERTGGRLGKVKGPTFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGS

Specifications

• Antigen: CHD1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_001270
• Gene Symbols: CHD1
• Immunogen: CHD1 (NP_001261, 1177 a.a. ∼ 1272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2b κ

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 1G2
• Description: Mouse monoclonal antibody raised against a partial recombinant CHD1.
• Gene: CHD1
• Gene Alias: DKFZp686E2337
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 1105
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid