Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89021071

CHD1 (M04), Mouse anti-Human, Clone: 1G2, Abnova™

Catalog No. 89021071 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-021-071 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-021-071 Supplier Abnova Corporation Supplier No. H00001105M04
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant CHD1.

The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template. [provided by RefSeq

Sequence: IKALKDSSSGTERTGGRLGKVKGPTFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGS

Specifications

Antigen CHD1
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 1G2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant CHD1.
Formulation PBS with no preservative; pH 7.4
Gene CHD1
Gene Accession No. NM_001270
Gene Alias DKFZp686E2337
Gene Symbols CHD1
Host Species Mouse
Immunogen CHD1 (NP_001261, 1177 a.a. ∼ 1272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1105
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.